Lineage for d2ok3a1 (2ok3 A:1-159)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806745Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 806746Superfamily b.62.1: Cyclophilin-like [50891] (4 families) (S)
  5. 806747Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 806912Protein Cyclophilin-like protein PPIL3B [141509] (1 species)
  7. 806913Species Human (Homo sapiens) [TaxId:9606] [141510] (3 PDB entries)
    Uniprot Q9H2H8 1-160
  8. 806914Domain d2ok3a1: 2ok3 A:1-159 [148800]
    automatically matched to d1xyha1
    complexed with ni

Details for d2ok3a1

PDB Entry: 2ok3 (more details), 2 Å

PDB Description: X-ray structure of human cyclophilin J at 2.0 angstrom
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase-like 3

SCOP Domain Sequences for d2ok3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]}
msvtlhtdvgdikievfcertpktcenflalcasnyyngcifhrnikgfmvqtgdptgtg
rggnsiwgkkfedeyseylkhnvrgvvsmanngpntngsqffitygkqphldmkytvfgk
vidgletldeleklpvnektyrplndvhikditihanpf

SCOP Domain Coordinates for d2ok3a1:

Click to download the PDB-style file with coordinates for d2ok3a1.
(The format of our PDB-style files is described here.)

Timeline for d2ok3a1: