Lineage for d2ok3a_ (2ok3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806901Protein Cyclophilin-like protein PPIL3B [141509] (1 species)
  7. 2806902Species Human (Homo sapiens) [TaxId:9606] [141510] (3 PDB entries)
    Uniprot Q9H2H8 1-160
  8. 2806903Domain d2ok3a_: 2ok3 A: [148800]
    automated match to d1xyha1
    complexed with ni

Details for d2ok3a_

PDB Entry: 2ok3 (more details), 2 Å

PDB Description: X-ray structure of human cyclophilin J at 2.0 angstrom
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase-like 3

SCOPe Domain Sequences for d2ok3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ok3a_ b.62.1.1 (A:) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]}
msvtlhtdvgdikievfcertpktcenflalcasnyyngcifhrnikgfmvqtgdptgtg
rggnsiwgkkfedeyseylkhnvrgvvsmanngpntngsqffitygkqphldmkytvfgk
vidgletldeleklpvnektyrplndvhikditihanpfa

SCOPe Domain Coordinates for d2ok3a_:

Click to download the PDB-style file with coordinates for d2ok3a_.
(The format of our PDB-style files is described here.)

Timeline for d2ok3a_: