Lineage for d2oiwc_ (2oiw C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943561Protein GK1870 orthologue [160182] (1 species)
    Predicted 4-hydroxybenzoyl-CoA thioesterase
  7. 2943562Species Bacillus stearothermophilus [TaxId:1422] [160183] (1 PDB entry)
    Uniprot Q5KYT1 1-131
  8. 2943565Domain d2oiwc_: 2oiw C: [148796]
    automated match to d2oiwa1
    complexed with edo, mg

Details for d2oiwc_

PDB Entry: 2oiw (more details), 2 Å

PDB Description: The structure of a predicted thioesterase from Bacillus stearothermophilus
PDB Compounds: (C:) putative 4-hydroxybenzoyl-CoA thioesterase

SCOPe Domain Sequences for d2oiwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oiwc_ d.38.1.1 (C:) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]}
amfttvitprvsetdgvghinnttvpvwfeagrheifklftpdlsfkrwrmviirmevdy
vnqmyygqdvtvytgierigntsltiyeeihqngvvcakgrsvyvnfnfdtgrpepipdd
irvklrehvwqpg

SCOPe Domain Coordinates for d2oiwc_:

Click to download the PDB-style file with coordinates for d2oiwc_.
(The format of our PDB-style files is described here.)

Timeline for d2oiwc_: