Lineage for d2oipe2 (2oip E:181-521)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1038908Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1038909Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 1038910Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1038911Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)
  7. 1038912Species Cryptosporidium hominis [TaxId:237895] [100887] (4 PDB entries)
  8. 1038919Domain d2oipe2: 2oip E:181-521 [148793]
    Other proteins in same PDB: d2oipa1, d2oipb1, d2oipc1, d2oipd1, d2oipe1
    automatically matched to d1qzfa2
    complexed with cb3, mtx, ndp, ump; mutant

Details for d2oipe2

PDB Entry: 2oip (more details), 2.8 Å

PDB Description: crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis
PDB Compounds: (E:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d2oipe2:

Sequence, based on SEQRES records: (download)

>d2oipe2 d.117.1.1 (E:181-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfik
gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
prpfpqlkfkrkveniedfkwedieligyypyptikmdmav

Sequence, based on observed residues (ATOM records): (download)

>d2oipe2 d.117.1.1 (E:181-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
ktgqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvl
engayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgdtngnhl
iekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdql
aklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlg
lgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlk
fkrkveniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d2oipe2:

Click to download the PDB-style file with coordinates for d2oipe2.
(The format of our PDB-style files is described here.)

Timeline for d2oipe2: