SCOP 1.75: Domain d2oipe1: 2oip E:3-180

Lineage for d2oipe1 (2oip E:3-180)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)

7. Species Cryptosporidium hominis [TaxId:237895] [102636] (3 PDB entries)
   Uniprot Q5CGA3 Q27552

8. Domain d2oipe1: 2oip E:3-180 [148792]
   Other proteins in same PDB: d2oipa2, d2oipb2, d2oipc2, d2oipd2, d2oipe2
   automatically matched to d1qzfa1
   complexed with cb3, mtx, ndp, ump; mutant

Details for d2oipe1

PDB Entry: 2oip, 2.8 Å

PDB Description: crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis

PDB Compounds: (E:) Chain A, crystal structure of Dhfr

SCOP Domain Sequences for d2oipe1:

Sequence; same for both SEQRES and ATOM records:

>d2oipe1 c.71.1.1 (E:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

Timeline for d2oipe1:

• d2oipe1 is new in SCOP 1.75
  
• d2oipe1 appears in SCOPe 2.01
  
• d2oipe1 appears in the current release, SCOPe 2.08