Lineage for d2oipc2 (2oip C:186-521)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871398Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 871399Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 871400Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 871401Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)
  7. 871402Species Cryptosporidium hominis [TaxId:237895] [100887] (4 PDB entries)
  8. 871417Domain d2oipc2: 2oip C:186-521 [148789]
    Other proteins in same PDB: d2oipa1, d2oipb1, d2oipc1, d2oipd1, d2oipe1
    automatically matched to d1qzfa2
    complexed with cb3, mtx, ndp, ump; mutant

Details for d2oipc2

PDB Entry: 2oip (more details), 2.8 Å

PDB Description: crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis
PDB Compounds: (C:) Chain A, crystal structure of Dhfr

SCOP Domain Sequences for d2oipc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oipc2 d.117.1.1 (C:186-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
cdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldlls
rvlengayrenrtgistysifgqmmrfdmresfpllttkkvairgifeeliwfikgdtng
nhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgv
dqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrsc
dlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfp
qlkfkrkveniedfkwedieligyypyptikmdmav

SCOP Domain Coordinates for d2oipc2:

Click to download the PDB-style file with coordinates for d2oipc2.
(The format of our PDB-style files is described here.)

Timeline for d2oipc2: