Lineage for d2oipc1 (2oip C:3-180)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618271Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1618272Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1618684Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1618685Protein automated matches [190777] (17 species)
    not a true protein
  7. 1618807Species Cryptosporidium hominis [TaxId:237895] [231999] (4 PDB entries)
  8. 1618815Domain d2oipc1: 2oip C:3-180 [148788]
    Other proteins in same PDB: d2oipa2, d2oipb2, d2oipc2, d2oipd2, d2oipe2
    automated match to d2oipc1
    complexed with cb3, mtx, ndp, ump; mutant

Details for d2oipc1

PDB Entry: 2oip (more details), 2.8 Å

PDB Description: crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis
PDB Compounds: (C:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d2oipc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oipc1 c.71.1.0 (C:3-180) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOPe Domain Coordinates for d2oipc1:

Click to download the PDB-style file with coordinates for d2oipc1.
(The format of our PDB-style files is described here.)

Timeline for d2oipc1: