| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) ![]() |
| Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) |
| Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species) |
| Species Cryptosporidium hominis [TaxId:237895] [102636] (3 PDB entries) Uniprot Q5CGA3 Q27552 |
| Domain d2oipc1: 2oip C:3-180 [148788] Other proteins in same PDB: d2oipa2, d2oipb2, d2oipc2, d2oipd2, d2oipe2 automatically matched to d1qzfa1 complexed with cb3, mtx, ndp, ump; mutant |
PDB Entry: 2oip (more details), 2.8 Å
SCOP Domain Sequences for d2oipc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oipc1 c.71.1.1 (C:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
Timeline for d2oipc1: