SCOPe 2.06: Domain d2oipa1: 2oip A:3-180

Lineage for d2oipa1 (2oip A:3-180)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Cryptosporidium hominis [TaxId:237895] [231999] (4 PDB entries)

8. Domain d2oipa1: 2oip A:3-180 [148784]
   Other proteins in same PDB: d2oipa2, d2oipb2, d2oipc2, d2oipd2, d2oipe2
   automated match to d2oipa1
   complexed with cb3, mtx, ndp, ump; mutant

Details for d2oipa1

PDB Entry: 2oip, 2.8 Å

PDB Description: crystal structure of the s290g active site mutant of ts-dhfr from cryptosporidium hominis

PDB Compounds: (A:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d2oipa1:

Sequence; same for both SEQRES and ATOM records:

>d2oipa1 c.71.1.0 (A:3-180) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

Timeline for d2oipa1:

• d2oipa1 first appeared in SCOP 1.75
  
• d2oipa1 appears in SCOPe 2.05
  
• d2oipa1 appears in SCOPe 2.07
  
• d2oipa1 appears in the current release, SCOPe 2.08