SCOPe 2.06: Domain d2oi0a2: 2oi0 A:216-477

Lineage for d2oi0a2 (2oi0 A:216-477)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
   automatically mapped to Pfam PF13574
   automatically mapped to Pfam PF13583

6. Protein automated matches [190185] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186923] (2 PDB entries)

8. Domain d2oi0a2: 2oi0 A:216-477 [148777]
   Other proteins in same PDB: d2oi0a3
   automated match to d1bkca_
   complexed with 283, zn

Details for d2oi0a2

PDB Entry: 2oi0, 2 Å

PDB Description: crystal structure analysis 0f the tnf-a coverting enzyme (tace) in complexed with aryl-sulfonamide

PDB Compounds: (A:) TNF- a Converting Enzyme (TACE)

SCOPe Domain Sequences for d2oi0a2:

Sequence; same for both SEQRES and ATOM records:

>d2oi0a2 d.92.1.10 (A:216-477) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adpdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgy
giqieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvcla
hlftyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktil
tkeadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcsk
qsiyktieskaqecfqersnkv

Timeline for d2oi0a2:

• d2oi0a2 first appeared in SCOP 1.75, called d2oi0a1
  
• d2oi0a2 was called d2oi0a_ in SCOPe 2.05
  
• d2oi0a2 appears in SCOPe 2.07
  
• d2oi0a2 appears in the current release, SCOPe 2.08