SCOP 1.75: Domain d2ohwb1: 2ohw B:3-130

Lineage for d2ohwb1 (2ohw B:3-130)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.8: YueI-like [160515] (1 family)

5. Family d.79.8.1: YueI-like [160516] (1 protein)
   Pfam PF07997; DUF1694

6. Protein Uncharacterized protein YueI [160517] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [160518] (1 PDB entry)
   Uniprot O32092 3-130

8. Domain d2ohwb1: 2ohw B:3-130 [148776]
   automatically matched to 2OHW A:3-130

Details for d2ohwb1

PDB Entry: 2ohw, 1.4 Å

PDB Description: crystal structure of the yuei protein from bacillus subtilis

PDB Compounds: (B:) YueI protein

SCOP Domain Sequences for d2ohwb1:

Sequence; same for both SEQRES and ATOM records:

>d2ohwb1 d.79.8.1 (B:3-130) Uncharacterized protein YueI {Bacillus subtilis [TaxId: 1423]}
edkmdlylqqgmygpletkpderhlflgslrervvlaltkgqvlrskpykeaehelknsh
nvtllingelqyqsyssyiqmasrygvpfkivsdlqfhtplgiviaadiavnreliyiqd
diynrsvl

Timeline for d2ohwb1:

• d2ohwb1 is new in SCOP 1.75
  
• d2ohwb1 is called d2ohwb_ in SCOPe 2.01
  
• d2ohwb1 appears in the current release, SCOPe 2.08, called d2ohwb_