SCOPe 2.05: Domain d2ogob1: 2ogo B:1-205

Lineage for d2ogob1 (2ogo B:1-205)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
   automatically mapped to Pfam PF00297

6. Protein Ribosomal protein L3 [50462] (4 species)
   superfamily fold is elaborated with additional structures

7. Species Deinococcus radiodurans [TaxId:1299] [159160] (9 PDB entries)
   Uniprot Q9RXK2 1-205

8. Domain d2ogob1: 2ogo B:1-205 [148773]
   automatically matched to 2ZJR B:1-205
   complexed with g34

Details for d2ogob1

PDB Entry: 2ogo, 3.66 Å

PDB Description: The crystal structure of the large ribosomal subunit from Deinococcus radiodurans complexed with the pleuromutilin derivative retapamulin (SB-275833)

PDB Compounds: (B:) 50S ribosomal protein L3

SCOPe Domain Sequences for d2ogob1:

Sequence; same for both SEQRES and ATOM records:

>d2ogob1 b.43.3.2 (B:1-205) Ribosomal protein L3 {Deinococcus radiodurans [TaxId: 1299]}
mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
lilvkgaipgangglvvlrsaakas

Timeline for d2ogob1:

• d2ogob1 first appeared in SCOP 1.75
  
• d2ogob1 appears in SCOPe 2.04
  
• d2ogob1 appears in SCOPe 2.06
  
• d2ogob1 appears in the current release, SCOPe 2.08