![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) automatically mapped to Pfam PF00297 |
![]() | Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
![]() | Species Deinococcus radiodurans [TaxId:1299] [159160] (9 PDB entries) Uniprot Q9RXK2 1-205 |
![]() | Domain d2ogob1: 2ogo B:1-205 [148773] automatically matched to 2ZJR B:1-205 complexed with g34 |
PDB Entry: 2ogo (more details), 3.66 Å
SCOPe Domain Sequences for d2ogob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ogob1 b.43.3.2 (B:1-205) Ribosomal protein L3 {Deinococcus radiodurans [TaxId: 1299]} mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen lilvkgaipgangglvvlrsaakas
Timeline for d2ogob1: