Lineage for d2ogob1 (2ogo B:1-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793163Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
    automatically mapped to Pfam PF00297
  6. 2793164Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 2793165Species Deinococcus radiodurans [TaxId:1299] [159160] (9 PDB entries)
    Uniprot Q9RXK2 1-205
  8. 2793172Domain d2ogob1: 2ogo B:1-205 [148773]
    automatically matched to 2ZJR B:1-205
    complexed with g34

Details for d2ogob1

PDB Entry: 2ogo (more details), 3.66 Å

PDB Description: The crystal structure of the large ribosomal subunit from Deinococcus radiodurans complexed with the pleuromutilin derivative retapamulin (SB-275833)
PDB Compounds: (B:) 50S ribosomal protein L3

SCOPe Domain Sequences for d2ogob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ogob1 b.43.3.2 (B:1-205) Ribosomal protein L3 {Deinococcus radiodurans [TaxId: 1299]}
mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
lilvkgaipgangglvvlrsaakas

SCOPe Domain Coordinates for d2ogob1:

Click to download the PDB-style file with coordinates for d2ogob1.
(The format of our PDB-style files is described here.)

Timeline for d2ogob1: