Lineage for d2ogka1 (2ogk A:4-144)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958441Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2958442Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2958534Family d.77.1.2: SSO1042-like [160489] (5 proteins)
    Pfam PF01877; DUF54
  6. 2958541Protein Hypothetical protein AF2318 [160492] (1 species)
  7. 2958542Species Archaeoglobus fulgidus [TaxId:2234] [160493] (1 PDB entry)
    Uniprot O27966 3-143
  8. 2958543Domain d2ogka1: 2ogk A:4-144 [148767]

Details for d2ogka1

PDB Entry: 2ogk (more details), 3 Å

PDB Description: crystal structure of protein af2318 from archaeglobus fulgidus, pfam duf54
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ogka1:

Sequence, based on SEQRES records: (download)

>d2ogka1 d.77.1.2 (A:4-144) Hypothetical protein AF2318 {Archaeoglobus fulgidus [TaxId: 2234]}
gkiewvrvsavvhstedrekvgeaistlfpfefeiavskakghygnpmeyleveltksse
ikkfwknllellgeqaeeilstledrideqnvlhiridkqkaylgevsltsggdpiavkl
rlvtypskrekviefarelct

Sequence, based on observed residues (ATOM records): (download)

>d2ogka1 d.77.1.2 (A:4-144) Hypothetical protein AF2318 {Archaeoglobus fulgidus [TaxId: 2234]}
gkiewvrvsavvhstedrekvgeaistlfpfefeiavskmeyleveltksseikkfwknl
lellgeqaeeilstledrideqnvlhiridkqkaylgevsltsggdpiavklrlvtypsk
rekviefarelct

SCOPe Domain Coordinates for d2ogka1:

Click to download the PDB-style file with coordinates for d2ogka1.
(The format of our PDB-style files is described here.)

Timeline for d2ogka1: