Lineage for d2ogga1 (2ogg A:95-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005715Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 3005716Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) (S)
  5. 3005731Family d.190.1.2: UTRA domain [143473] (11 proteins)
    Pfam PF07702
  6. 3005778Protein Trehalose operon transcriptional repressor TreR [160401] (1 species)
    formerly YfxA
  7. 3005779Species Bacillus subtilis [TaxId:1423] [160402] (1 PDB entry)
    Uniprot P39796 95-238
  8. 3005780Domain d2ogga1: 2ogg A:95-238 [148766]
    complexed with gol, na, so4

Details for d2ogga1

PDB Entry: 2ogg (more details), 2.5 Å

PDB Description: Structure of B. subtilis trehalose repressor (TreR) effector binding domain
PDB Compounds: (A:) Trehalose operon transcriptional repressor

SCOPe Domain Sequences for d2ogga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ogga1 d.190.1.2 (A:95-238) Trehalose operon transcriptional repressor TreR {Bacillus subtilis [TaxId: 1423]}
tkttvhkfgleppseliqkqlranldddiwevirsrkidgehvildkdyffrkhvphltk
eicensiyeyiegelglsisyaqkeivaepctdedrelldlrgydhmvvvrnyvfledts
lfqytesrhrldkfrfvdfarrgk

SCOPe Domain Coordinates for d2ogga1:

Click to download the PDB-style file with coordinates for d2ogga1.
(The format of our PDB-style files is described here.)

Timeline for d2ogga1: