![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
![]() | Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) ![]() |
![]() | Family d.190.1.2: UTRA domain [143473] (11 proteins) Pfam PF07702 |
![]() | Protein Trehalose operon transcriptional repressor TreR [160401] (1 species) formerly YfxA |
![]() | Species Bacillus subtilis [TaxId:1423] [160402] (1 PDB entry) Uniprot P39796 95-238 |
![]() | Domain d2ogga1: 2ogg A:95-238 [148766] complexed with gol, na, so4 |
PDB Entry: 2ogg (more details), 2.5 Å
SCOPe Domain Sequences for d2ogga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ogga1 d.190.1.2 (A:95-238) Trehalose operon transcriptional repressor TreR {Bacillus subtilis [TaxId: 1423]} tkttvhkfgleppseliqkqlranldddiwevirsrkidgehvildkdyffrkhvphltk eicensiyeyiegelglsisyaqkeivaepctdedrelldlrgydhmvvvrnyvfledts lfqytesrhrldkfrfvdfarrgk
Timeline for d2ogga1: