Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.345: NRDP1 C-terminal domain-like [160087] (1 superfamily) alpha-beta-alpha(3)-beta(3); a pseudo barrel beta-sheet of an SH3-like topology, surrounded by helices |
Superfamily d.345.1: NRDP1 C-terminal domain-like [160088] (1 family) automatically mapped to Pfam PF08941 |
Family d.345.1.1: USP8 interacting domain [160089] (1 protein) Pfam PF08941 |
Protein E3 ubiquitin-protein ligase NRDP1 [160090] (1 species) RING finger protein 41 |
Species Human (Homo sapiens) [TaxId:9606] [160091] (3 PDB entries) Uniprot Q9H4P4 193-317! Uniprot Q9H4P4 197-317 |
Domain d2ogba_: 2ogb A: [148764] Other proteins in same PDB: d2ogbb3 automated match to d2fzpa1 complexed with gol, scn |
PDB Entry: 2ogb (more details), 1.95 Å
SCOPe Domain Sequences for d2ogba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ogba_ d.345.1.1 (A:) E3 ubiquitin-protein ligase NRDP1 {Human (Homo sapiens) [TaxId: 9606]} eyneilewvnslqparvtrwggmistpdavlqavikrslvesgcpasivnelienahers wpqglatletrqmnrryyenyvakripgkqavvvmacenqhmgddmvqepglvmifahgv eei
Timeline for d2ogba_: