![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
![]() | Protein Putative transcriptional regulator RHA1_ro04071 [158461] (1 species) |
![]() | Species Rhodococcus sp. RHA1 [TaxId:101510] [158462] (1 PDB entry) Uniprot Q0S9B8 3-84 |
![]() | Domain d2ofyb_: 2ofy B: [148763] automated match to d2ofya1 |
PDB Entry: 2ofy (more details), 1.7 Å
SCOPe Domain Sequences for d2ofyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ofyb_ a.35.1.3 (B:) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]} pltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpafftiaava rvldlslddvaavvtfgpvs
Timeline for d2ofyb_: