Lineage for d2ofyb_ (2ofy B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318756Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2318757Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2318854Family a.35.1.3: SinR domain-like [47432] (9 protein domains)
  6. 2318919Protein Putative transcriptional regulator RHA1_ro04071 [158461] (1 species)
  7. 2318920Species Rhodococcus sp. RHA1 [TaxId:101510] [158462] (1 PDB entry)
    Uniprot Q0S9B8 3-84
  8. 2318922Domain d2ofyb_: 2ofy B: [148763]
    automated match to d2ofya1

Details for d2ofyb_

PDB Entry: 2ofy (more details), 1.7 Å

PDB Description: Crystal structure of putative XRE-family transcriptional regulator from Rhodococcus sp.
PDB Compounds: (B:) Putative XRE-family transcriptional regulator

SCOPe Domain Sequences for d2ofyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofyb_ a.35.1.3 (B:) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]}
pltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpafftiaava
rvldlslddvaavvtfgpvs

SCOPe Domain Coordinates for d2ofyb_:

Click to download the PDB-style file with coordinates for d2ofyb_.
(The format of our PDB-style files is described here.)

Timeline for d2ofyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ofya1