SCOPe 2.08: Domain d2ofyb_: 2ofy B:

Lineage for d2ofyb_ (2ofy B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Putative transcriptional regulator RHA1_ro04071 [158461] (1 species)

7. Species Rhodococcus sp. RHA1 [TaxId:101510] [158462] (1 PDB entry)
   Uniprot Q0S9B8 3-84

8. Domain d2ofyb_: 2ofy B: [148763]
   automated match to d2ofya1

Details for d2ofyb_

PDB Entry: 2ofy, 1.7 Å

PDB Description: crystal structure of putative xre-family transcriptional regulator from rhodococcus sp.

PDB Compounds: (B:) Putative XRE-family transcriptional regulator

SCOPe Domain Sequences for d2ofyb_:

Sequence; same for both SEQRES and ATOM records:

>d2ofyb_ a.35.1.3 (B:) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]}
pltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpafftiaava
rvldlslddvaavvtfgpvs

Timeline for d2ofyb_:

• d2ofyb_ first appeared in SCOP 1.75, called d2ofyb1
  
• d2ofyb_ appears in SCOPe 2.07