SCOPe 2.07: Domain d2ofya1: 2ofy A:3-84

Lineage for d2ofya1 (2ofy A:3-84)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Putative transcriptional regulator RHA1_ro04071 [158461] (1 species)

7. Species Rhodococcus sp. RHA1 [TaxId:101510] [158462] (1 PDB entry)
   Uniprot Q0S9B8 3-84

8. Domain d2ofya1: 2ofy A:3-84 [148762]

Details for d2ofya1

PDB Entry: 2ofy, 1.7 Å

PDB Description: crystal structure of putative xre-family transcriptional regulator from rhodococcus sp.

PDB Compounds: (A:) Putative XRE-family transcriptional regulator

SCOPe Domain Sequences for d2ofya1:

Sequence; same for both SEQRES and ATOM records:

>d2ofya1 a.35.1.3 (A:3-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]}
rvpltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpafftiaa
varvldlslddvaavvtfgpvs

Timeline for d2ofya1:

• d2ofya1 first appeared in SCOP 1.75
  
• d2ofya1 appears in SCOPe 2.06
  
• d2ofya1 appears in the current release, SCOPe 2.08