Lineage for d2ofya1 (2ofy A:3-84)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709481Protein Putative transcriptional regulator RHA1_ro04071 [158461] (1 species)
  7. 2709482Species Rhodococcus sp. RHA1 [TaxId:101510] [158462] (1 PDB entry)
    Uniprot Q0S9B8 3-84
  8. 2709483Domain d2ofya1: 2ofy A:3-84 [148762]

Details for d2ofya1

PDB Entry: 2ofy (more details), 1.7 Å

PDB Description: crystal structure of putative xre-family transcriptional regulator from rhodococcus sp.
PDB Compounds: (A:) Putative XRE-family transcriptional regulator

SCOPe Domain Sequences for d2ofya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofya1 a.35.1.3 (A:3-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]}
rvpltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpafftiaa
varvldlslddvaavvtfgpvs

SCOPe Domain Coordinates for d2ofya1:

Click to download the PDB-style file with coordinates for d2ofya1.
(The format of our PDB-style files is described here.)

Timeline for d2ofya1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ofyb_