Lineage for d2oezb_ (2oez B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626290Fold e.68: YacF-like [160949] (1 superfamily)
    2 domains; d1: kinked four-helical bundle, inserted in d2: beta-sandwich of 7 strands in two sheets
  4. 2626291Superfamily e.68.1: YacF-like [160950] (1 family) (S)
    probable biological unit is a dimer
    automatically mapped to Pfam PF07072
  5. 2626292Family e.68.1.1: YacF-like [160951] (1 protein)
    Pfam PF07072; DUF1342
  6. 2626293Protein Uncharacterized protein VP2528 [160952] (1 species)
  7. 2626294Species Vibrio parahaemolyticus [TaxId:670] [160953] (1 PDB entry)
    Uniprot Q87LT3 1-245
  8. 2626296Domain d2oezb_: 2oez B: [148759]
    Other proteins in same PDB: d2oeza2
    automated match to d2oeza1

Details for d2oezb_

PDB Entry: 2oez (more details), 1.97 Å

PDB Description: protein of unknown function (duf1342) from vibrio parahaemolyticus
PDB Compounds: (B:) UPF0289 protein VP2528

SCOPe Domain Sequences for d2oezb_:

Sequence, based on SEQRES records: (download)

>d2oezb_ e.68.1.1 (B:) Uncharacterized protein VP2528 {Vibrio parahaemolyticus [TaxId: 670]}
tthkfehplnektriylrvesllrqahlasgfadnhqyqlffralfdmveifeqiqlkse
lakdlekqrlsyrhwlnvegvdqealnsllneidvvhsqlmgaerfgqalkedrflssir
qrfnlpggsccfdlpalhywlhlpierkkhdanqwqkslkplsdaltlwlklaretghfk
aqiaragffqsdadeanilrlhipmkygvypmisghknrfaikfmafengqacsqdvefe
lavc

Sequence, based on observed residues (ATOM records): (download)

>d2oezb_ e.68.1.1 (B:) Uncharacterized protein VP2528 {Vibrio parahaemolyticus [TaxId: 670]}
tthkfehplnektriylrvesllrqahlasgfadnhqyqlffralfdmveifeqiqlkse
lakdlekqrlsyrhwlnvegvdqealnsllneidvvhsqlmgaerfgqalkedrflssir
qrfnlpggccfdlpalhywlhlpierkkhdanqwqkslkplsdaltlwlklaretghfka
qiaragffqsdadeanilrlhipmkygvypmisghknrfaikfmafengqacsqdvefel
avc

SCOPe Domain Coordinates for d2oezb_:

Click to download the PDB-style file with coordinates for d2oezb_.
(The format of our PDB-style files is described here.)

Timeline for d2oezb_: