Lineage for d2oezb1 (2oez B:2-245)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885959Fold e.68: YacF-like [160949] (1 superfamily)
    2 domains; d1: kinked four-helical bundle, inserted in d2: beta-sandwich of 7 strands in two sheets
  4. 885960Superfamily e.68.1: YacF-like [160950] (1 family) (S)
    probable biological unit is a dimer
  5. 885961Family e.68.1.1: YacF-like [160951] (1 protein)
    Pfam PF07072; DUF1342
  6. 885962Protein Uncharacterized protein VP2528 [160952] (1 species)
  7. 885963Species Vibrio parahaemolyticus [TaxId:670] [160953] (1 PDB entry)
    Uniprot Q87LT3 1-245
  8. 885965Domain d2oezb1: 2oez B:2-245 [148759]
    automatically matched to 2OEZ A:1-245

Details for d2oezb1

PDB Entry: 2oez (more details), 1.97 Å

PDB Description: protein of unknown function (duf1342) from vibrio parahaemolyticus
PDB Compounds: (B:) UPF0289 protein VP2528

SCOP Domain Sequences for d2oezb1:

Sequence, based on SEQRES records: (download)

>d2oezb1 e.68.1.1 (B:2-245) Uncharacterized protein VP2528 {Vibrio parahaemolyticus [TaxId: 670]}
tthkfehplnektriylrvesllrqahlasgfadnhqyqlffralfdmveifeqiqlkse
lakdlekqrlsyrhwlnvegvdqealnsllneidvvhsqlmgaerfgqalkedrflssir
qrfnlpggsccfdlpalhywlhlpierkkhdanqwqkslkplsdaltlwlklaretghfk
aqiaragffqsdadeanilrlhipmkygvypmisghknrfaikfmafengqacsqdvefe
lavc

Sequence, based on observed residues (ATOM records): (download)

>d2oezb1 e.68.1.1 (B:2-245) Uncharacterized protein VP2528 {Vibrio parahaemolyticus [TaxId: 670]}
tthkfehplnektriylrvesllrqahlasgfadnhqyqlffralfdmveifeqiqlkse
lakdlekqrlsyrhwlnvegvdqealnsllneidvvhsqlmgaerfgqalkedrflssir
qrfnlpggccfdlpalhywlhlpierkkhdanqwqkslkplsdaltlwlklaretghfka
qiaragffqsdadeanilrlhipmkygvypmisghknrfaikfmafengqacsqdvefel
avc

SCOP Domain Coordinates for d2oezb1:

Click to download the PDB-style file with coordinates for d2oezb1.
(The format of our PDB-style files is described here.)

Timeline for d2oezb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2oeza1