SCOPe 2.05: Domain d2oeqb_: 2oeq B:

Lineage for d2oeqb_ (2oeq B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.281: YheA-like [158621] (1 superfamily)
   5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces

4. Superfamily a.281.1: YheA/YmcA-like [158622] (2 families)

5. Family a.281.1.2: YheA-like [158626] (4 proteins)
   Pfam PF06133; DUF964

6. Protein automated matches [190757] (1 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [187955] (1 PDB entry)

8. Domain d2oeqb_: 2oeq B: [148755]
   Other proteins in same PDB: d2oeqa1
   automated match to d2oeqa1

Details for d2oeqb_

PDB Entry: 2oeq, 2.9 Å

PDB Description: protein of unknown function (duf964) from bacillus stearothermophilus

PDB Compounds: (B:) Protein of unknown function, DUF964

SCOPe Domain Sequences for d2oeqb_:

Sequence; same for both SEQRES and ATOM records:

>d2oeqb_ a.281.1.2 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
eplhalarqleqairasepfqqlkrayedvrrdetayrmfanvrdiqlrlhekqmrgaai
lpdeieqaqkamalaqqneklarlmaleqqmsitiaevqqiamkpleelhrsfm

Timeline for d2oeqb_:

• d2oeqb_ first appeared in SCOP 1.75, called d2oeqb1
  
• d2oeqb_ appears in SCOPe 2.04
  
• d2oeqb_ appears in SCOPe 2.06
  
• d2oeqb_ appears in the current release, SCOPe 2.08