Lineage for d2oeia1 (2oei A:253-285)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961395Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 961396Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 961397Family b.72.1.1: WW domain [51046] (12 proteins)
  6. 961398Protein Amyloid beta A4 precursor protein-binding family B member 1, APBB1 [159267] (1 species)
  7. 961399Species Human (Homo sapiens) [TaxId:9606] [159268] (4 PDB entries)
    Uniprot O00213 241-290! Uniprot O00213 253-285
  8. 961401Domain d2oeia1: 2oei A:253-285 [148753]
    automatically matched to 2HO2 A:253-285

Details for d2oeia1

PDB Entry: 2oei (more details), 1.35 Å

PDB Description: crystal structure of human fe65-ww domain in complex with human mena peptide
PDB Compounds: (A:) Amyloid beta A4 protein-binding family B member 1

SCOPe Domain Sequences for d2oeia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oeia1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]}
sdlpagwmrvqdtsgtyywhiptgttqweppgr

SCOPe Domain Coordinates for d2oeia1:

Click to download the PDB-style file with coordinates for d2oeia1.
(The format of our PDB-style files is described here.)

Timeline for d2oeia1: