| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.3: ARID-like [46774] (2 families) ![]() contains extra helices at both N- and C-termini |
| Family a.4.3.1: ARID domain [46775] (5 proteins) |
| Protein MRF-2 DNA-binding domain [46779] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46780] (2 PDB entries) |
| Domain d2oeha1: 2oeh A:1-107 [148752] automatically matched to d1ig6a_ protein/DNA complex |
PDB Entry: 2oeh (more details)
SCOPe Domain Sequences for d2oeha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oeha1 a.4.3.1 (A:1-107) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
radeqaflvalykymkerktpieripylgfkqinlwtmfqaaqklggyetitarrqwkhi
ydelggnpgstsaatctrrhyerlilpyerfikgeedkplppikprk
Timeline for d2oeha1: