Lineage for d2oeha1 (2oeh A:1-107)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692925Superfamily a.4.3: ARID-like [46774] (2 families) (S)
    contains extra helices at both N- and C-termini
  5. 2692926Family a.4.3.1: ARID domain [46775] (5 proteins)
  6. 2692931Protein MRF-2 DNA-binding domain [46779] (1 species)
  7. 2692932Species Human (Homo sapiens) [TaxId:9606] [46780] (2 PDB entries)
  8. 2692934Domain d2oeha1: 2oeh A:1-107 [148752]
    automatically matched to d1ig6a_
    protein/DNA complex

Details for d2oeha1

PDB Entry: 2oeh (more details)

PDB Description: determination of the three-dimensional structure of the mrf2-dna complex using paramagnetic spin labeling
PDB Compounds: (A:) AT-rich interactive domain-containing protein 5B

SCOPe Domain Sequences for d2oeha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oeha1 a.4.3.1 (A:1-107) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
radeqaflvalykymkerktpieripylgfkqinlwtmfqaaqklggyetitarrqwkhi
ydelggnpgstsaatctrrhyerlilpyerfikgeedkplppikprk

SCOPe Domain Coordinates for d2oeha1:

Click to download the PDB-style file with coordinates for d2oeha1.
(The format of our PDB-style files is described here.)

Timeline for d2oeha1: