SCOPe 2.08: Domain d2oeeb_: 2oee B:

Lineage for d2oeeb_ (2oee B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.281: YheA-like [158621] (1 superfamily)
   5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces

4. Superfamily a.281.1: YheA/YmcA-like [158622] (2 families)

5. Family a.281.1.2: YheA-like [158626] (4 proteins)
   Pfam PF06133; DUF964

6. Protein Hypothetical protein YheA [158627] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158628] (1 PDB entry)
   Uniprot O07542 3-112

8. Domain d2oeeb_: 2oee B: [148751]
   automated match to d2oeea1
   complexed with ca

Details for d2oeeb_

PDB Entry: 2oee, 1.96 Å

PDB Description: yheA from Bacillus subtilis

PDB Compounds: (B:) UPF0342 protein yheA

SCOPe Domain Sequences for d2oeeb_:

Sequence, based on SEQRES records:

>d2oeeb_ a.281.1.2 (B:) Hypothetical protein YheA {Bacillus subtilis [TaxId: 1423]}
vnfydvaydlenalrgseeftrlknlydevnadesakrmfenfrdvqlrlqqkqmageei
tqeevtqaqktvalvqqhekisqlmeaeqrmsmligelnkiimkpleely

Sequence, based on observed residues (ATOM records):

>d2oeeb_ a.281.1.2 (B:) Hypothetical protein YheA {Bacillus subtilis [TaxId: 1423]}
vnfydvaydlenalrgseeftrlknlydevnadesakrmfenfrdvqlrqaqktvalvqq
hekisqlmeaeqrmsmligelnkiimkpleely

Timeline for d2oeeb_:

• d2oeeb_ first appeared in SCOP 1.75, called d2oeeb1
  
• d2oeeb_ appears in SCOPe 2.07