![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.281: YheA-like [158621] (1 superfamily) 5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces |
![]() | Superfamily a.281.1: YheA/YmcA-like [158622] (2 families) ![]() |
![]() | Family a.281.1.2: YheA-like [158626] (4 proteins) Pfam PF06133; DUF964 |
![]() | Protein Hypothetical protein YheA [158627] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [158628] (1 PDB entry) Uniprot O07542 3-112 |
![]() | Domain d2oeeb_: 2oee B: [148751] automated match to d2oeea1 complexed with ca |
PDB Entry: 2oee (more details), 1.96 Å
SCOPe Domain Sequences for d2oeeb_:
Sequence, based on SEQRES records: (download)
>d2oeeb_ a.281.1.2 (B:) Hypothetical protein YheA {Bacillus subtilis [TaxId: 1423]} vnfydvaydlenalrgseeftrlknlydevnadesakrmfenfrdvqlrlqqkqmageei tqeevtqaqktvalvqqhekisqlmeaeqrmsmligelnkiimkpleely
>d2oeeb_ a.281.1.2 (B:) Hypothetical protein YheA {Bacillus subtilis [TaxId: 1423]} vnfydvaydlenalrgseeftrlknlydevnadesakrmfenfrdvqlrqaqktvalvqq hekisqlmeaeqrmsmligelnkiimkpleely
Timeline for d2oeeb_: