Lineage for d2oeea1 (2oee A:3-112)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739109Fold a.281: YheA-like [158621] (1 superfamily)
    5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces
  4. 2739110Superfamily a.281.1: YheA/YmcA-like [158622] (2 families) (S)
  5. 2739118Family a.281.1.2: YheA-like [158626] (4 proteins)
    Pfam PF06133; DUF964
  6. 2739125Protein Hypothetical protein YheA [158627] (1 species)
  7. 2739126Species Bacillus subtilis [TaxId:1423] [158628] (1 PDB entry)
    Uniprot O07542 3-112
  8. 2739127Domain d2oeea1: 2oee A:3-112 [148750]
    complexed with ca

Details for d2oeea1

PDB Entry: 2oee (more details), 1.96 Å

PDB Description: yheA from Bacillus subtilis
PDB Compounds: (A:) UPF0342 protein yheA

SCOPe Domain Sequences for d2oeea1:

Sequence, based on SEQRES records: (download)

>d2oeea1 a.281.1.2 (A:3-112) Hypothetical protein YheA {Bacillus subtilis [TaxId: 1423]}
vnfydvaydlenalrgseeftrlknlydevnadesakrmfenfrdvqlrlqqkqmageei
tqeevtqaqktvalvqqhekisqlmeaeqrmsmligelnkiimkpleely

Sequence, based on observed residues (ATOM records): (download)

>d2oeea1 a.281.1.2 (A:3-112) Hypothetical protein YheA {Bacillus subtilis [TaxId: 1423]}
vnfydvaydlenalrgseeftrlknlydevnadesakrmfenfrdvqlqaqktvalvqqh
ekisqlmeaeqrmsmligelnkiimkpleely

SCOPe Domain Coordinates for d2oeea1:

Click to download the PDB-style file with coordinates for d2oeea1.
(The format of our PDB-style files is described here.)

Timeline for d2oeea1: