Lineage for d2oeba1 (2oeb A:2-153)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717753Fold a.70: ATPD N-terminal domain-like [47927] (2 superfamilies)
    core: 5 helices; bundle
  4. 2717760Superfamily a.70.2: AF1862-like [158568] (2 families) (S)
    probable biological unit is a hexamer
  5. 2717761Family a.70.2.1: Cas Cmr5-like [158569] (1 protein)
    Pfam PF09701; CRISPR-associated protein
  6. 2717762Protein Hypothetical protein AF1862 [158570] (1 species)
  7. 2717763Species Archaeoglobus fulgidus [TaxId:2234] [158571] (1 PDB entry)
    Uniprot O28417 2-153
  8. 2717764Domain d2oeba1: 2oeb A:2-153 [148749]

Details for d2oeba1

PDB Entry: 2oeb (more details), 1.66 Å

PDB Description: The crystal structure of gene product Af1862 from Archaeoglobus fulgidus
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2oeba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oeba1 a.70.2.1 (A:2-153) Hypothetical protein AF1862 {Archaeoglobus fulgidus [TaxId: 2234]}
direieqerasfafkvvsdikdkysqnkkvqgkyssyaekaptiilnnglgatlafflsk
lekpiddvdyksinpesfgnaeniayaflykhlstwlaegngkdsafsgltngedplkyi
mektaidvaisteealsilnwikkfakamlee

SCOPe Domain Coordinates for d2oeba1:

Click to download the PDB-style file with coordinates for d2oeba1.
(The format of our PDB-style files is described here.)

Timeline for d2oeba1: