Lineage for d2odff_ (2odf F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2890025Family c.56.5.9: FGase-like [159652] (2 proteins)
    Pfam PF05013; N-formylglutamate amidohydrolase
  6. 2890026Protein Hypothetical protein Atu2144 [159655] (1 species)
  7. 2890027Species Agrobacterium tumefaciens [TaxId:358] [159656] (1 PDB entry)
    Uniprot Q8UDI1 6-257
  8. 2890033Domain d2odff_: 2odf F: [148746]
    automated match to d2odfa1
    complexed with so4

Details for d2odff_

PDB Entry: 2odf (more details), 1.9 Å

PDB Description: The crystal structure of gene product Atu2144 from Agrobacterium tumefaciens
PDB Compounds: (F:) Hypothetical protein Atu2144

SCOPe Domain Sequences for d2odff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odff_ c.56.5.9 (F:) Hypothetical protein Atu2144 {Agrobacterium tumefaciens [TaxId: 358]}
rffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalav
arllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsa
lyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamla
gaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagflh
elmgkalssie

SCOPe Domain Coordinates for d2odff_:

Click to download the PDB-style file with coordinates for d2odff_.
(The format of our PDB-style files is described here.)

Timeline for d2odff_: