Lineage for d2odfd1 (2odf D:7-256)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 838036Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 838394Family c.56.5.9: FGase-like [159652] (2 proteins)
    Pfam PF05013; N-formylglutamate amidohydrolase
  6. 838395Protein Hypothetical protein Atu2144 [159655] (1 species)
  7. 838396Species Agrobacterium tumefaciens [TaxId:358] [159656] (1 PDB entry)
    Uniprot Q8UDI1 6-257
  8. 838400Domain d2odfd1: 2odf D:7-256 [148744]
    automatically matched to 2ODF A:6-257
    complexed with so4

Details for d2odfd1

PDB Entry: 2odf (more details), 1.9 Å

PDB Description: The crystal structure of gene product Atu2144 from Agrobacterium tumefaciens
PDB Compounds: (D:) Hypothetical protein Atu2144

SCOP Domain Sequences for d2odfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odfd1 c.56.5.9 (D:7-256) Hypothetical protein Atu2144 {Agrobacterium tumefaciens [TaxId: 358]}
ffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalava
rllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsal
yvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamlag
aegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagflhe
lmgkalssie

SCOP Domain Coordinates for d2odfd1:

Click to download the PDB-style file with coordinates for d2odfd1.
(The format of our PDB-style files is described here.)

Timeline for d2odfd1: