![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.9: FGase-like [159652] (2 proteins) Pfam PF05013; N-formylglutamate amidohydrolase |
![]() | Protein Hypothetical protein Atu2144 [159655] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [159656] (1 PDB entry) Uniprot Q8UDI1 6-257 |
![]() | Domain d2odfa1: 2odf A:6-257 [148741] complexed with so4 |
PDB Entry: 2odf (more details), 1.9 Å
SCOPe Domain Sequences for d2odfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2odfa1 c.56.5.9 (A:6-257) Hypothetical protein Atu2144 {Agrobacterium tumefaciens [TaxId: 358]} rffteaegkavgvenaaakgdvllvcehasatipqkygtlglsadvlsshaawdpgalav arllsekfhatlvyqrfsrlvydcnrppespsampvkseiydipgnfdldeaerfartsa lyvpfhdrvseiiaerqaagrkvvvvtihsftpvyhgrfreveigilhdndsrladamla gaegasltvrrndpygpedgvthtlrlhalpdgllnvmieirndlianegeqaaiagflh elmgkalssiee
Timeline for d2odfa1: