Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.22: Marine metagenome family DABB1 [160301] (2 proteins) |
Protein Hypothetical protein GOS_2359375 [160304] (1 species) |
Species Environmental samples [TaxId:33858] [160305] (1 PDB entry) marine metagenome |
Domain d2od6d1: 2od6 D:2-109 [148740] automatically matched to 2OD6 A:1-109 complexed with edo, oha |
PDB Entry: 2od6 (more details), 1.85 Å
SCOPe Domain Sequences for d2od6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2od6d1 d.58.4.22 (D:2-109) Hypothetical protein GOS_2359375 {Environmental samples [TaxId: 33858]} aepkftsfttadfindvdmelfidavektapvwvkemksrgllkfsmnrvwnkgevfrvv mtyeykdrasfeaniayledtfgknpvflqlvttakfttsrclvvmev
Timeline for d2od6d1: