Lineage for d2od5a1 (2od5 A:6-96)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 763014Family a.4.5.70: Marine metagenome family WH1 [158296] (1 protein)
  6. 763015Protein Hypothetical protein GOS_3836187 [158297] (1 species)
  7. 763016Species Environmental samples [TaxId:33858] [158298] (1 PDB entry)
    marine metagenome
  8. 763017Domain d2od5a1: 2od5 A:6-96 [148736]
    complexed with 1pe, cl, edo, imd

Details for d2od5a1

PDB Entry: 2od5 (more details), 1.79 Å

PDB Description: crystal structure of a putative nucleic acid binding protein (jcvi_pep_1096688149193) from uncultured marine organism at 1.79 a resolution
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2od5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2od5a1 a.4.5.70 (A:6-96) Hypothetical protein GOS_3836187 {Environmental samples}
etesmktvrirekikkflgdrprntaeilehinstmrhgttsqqlgnvlskdkdivkvgy
ikrsgilsggydicewatrnwvaehcpewte

SCOP Domain Coordinates for d2od5a1:

Click to download the PDB-style file with coordinates for d2od5a1.
(The format of our PDB-style files is described here.)

Timeline for d2od5a1: