Lineage for d2od4a1 (2od4 A:1-100)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517142Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2517481Family d.58.4.20: Marine metagenome family DABB2 [160295] (1 protein)
  6. 2517482Protein Hypothetical protein GOS_3280838 [160296] (1 species)
  7. 2517483Species Environmental samples [TaxId:33858] [160297] (1 PDB entry)
  8. 2517484Domain d2od4a1: 2od4 A:1-100 [148734]
    complexed with cl, edo

Details for d2od4a1

PDB Entry: 2od4 (more details), 1.7 Å

PDB Description: crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096665735785) from uncultured marine organism at 1.70 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2od4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2od4a1 d.58.4.20 (A:1-100) Hypothetical protein GOS_3280838 {Environmental samples [TaxId: 33858]}
mfagsipmyirvvsitaqsklqfdmtvtyfenvwspkvislgaisaefvqsnensgmyii
hypdkqtaisvfdkikpevdevrtqnriqitegkrlfrvd

SCOPe Domain Coordinates for d2od4a1:

Click to download the PDB-style file with coordinates for d2od4a1.
(The format of our PDB-style files is described here.)

Timeline for d2od4a1: