Lineage for d2od4a1 (2od4 A:1-100)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.20: Marine metagenome family DABB2 [160295] (1 protein) Protein Hypothetical protein GOS_3280838 [160296] (1 species) Species Environmental samples [TaxId:33858] [160297] (1 PDB entry) 
Domain d2od4a1: 2od4 A:1-100 [148734]
complexed with cl, edo
Details for d2od4a1
PDB Entry: 2od4 (more details), 1.7 Å
PDB Description: crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096665735785) from uncultured marine organism at 1.70 a resolution
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d2od4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2od4a1 d.58.4.20 (A:1-100) Hypothetical protein GOS_3280838 {Environmental samples [TaxId: 33858]}
mfagsipmyirvvsitaqsklqfdmtvtyfenvwspkvislgaisaefvqsnensgmyii
hypdkqtaisvfdkikpevdevrtqnriqitegkrlfrvd
SCOPe Domain Coordinates for d2od4a1:
Click to download the PDB-style file with coordinates for d2od4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2od4a1:
- d2od4a1 first appeared in SCOP 1.75
- d2od4a1 appears in SCOPe 2.07
View in 3D
