Lineage for d2od0a1 (2od0 A:3-105)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879922Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 880045Superfamily d.198.5: YgaC/TfoX-N like [159894] (2 families) (S)
    overall similar to the Type III secretory system chaperone subunits; different shape of the beta-sheet
  5. 880050Family d.198.5.2: TfoX N-terminal domain-like [159898] (1 protein)
    Pfam PF04993
  6. 880051Protein Hypothetical protein VP1028 [159899] (1 species)
  7. 880052Species Vibrio parahaemolyticus [TaxId:670] [159900] (1 PDB entry)
    Uniprot Q87QX1 3-105
  8. 880053Domain d2od0a1: 2od0 A:3-105 [148732]
    complexed with mg, so4

Details for d2od0a1

PDB Entry: 2od0 (more details), 1.95 Å

PDB Description: The crystal structure of gene product VP1028 from Vibrio parahaemolyticus
PDB Compounds: (A:) Hypothetical protein VP1028

SCOP Domain Sequences for d2od0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2od0a1 d.198.5.2 (A:3-105) Hypothetical protein VP1028 {Vibrio parahaemolyticus [TaxId: 670]}
kpilkdsmklfealgtiksrsmfggfglfadetmfalvvnnqlhiradqqtssdfetqgl
kpyvykkrgfpvvtkyyaisselwessdrlievakkslenakl

SCOP Domain Coordinates for d2od0a1:

Click to download the PDB-style file with coordinates for d2od0a1.
(The format of our PDB-style files is described here.)

Timeline for d2od0a1: