| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) ![]() consists of one domain of this fold |
| Family c.55.3.13: Tex RuvX-like domain-like [159635] (1 protein) |
| Protein Transcriptional accessory factor Tex [159636] (1 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [159637] (3 PDB entries) Uniprot Q9HTY8 325-473 |
| Domain d2ocea5: 2oce A:325-473 [148731] Other proteins in same PDB: d2ocea1, d2ocea2, d2ocea3, d2ocea4 |
PDB Entry: 2oce (more details), 3.1 Å
SCOP Domain Sequences for d2ocea5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ocea5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}
pagpratlgldpglrtgvkvavvdatgklldtatvyphapknqwdqtlavlaalcakhqv
eliaigngtasretdklagelikkypgmkltkimvseagasvysaselaakefpeldvsl
rgavsiarrlqdplaelvkiepksigvgq
Timeline for d2ocea5:
View in 3DDomains from same chain: (mouse over for more information) d2ocea1, d2ocea2, d2ocea3, d2ocea4 |