SCOPe 2.05: Domain d2ocea4: 2oce A:637-730

Lineage for d2ocea4 (2oce A:637-730)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Tex S1-domain [159106] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [159107] (3 PDB entries)
   Uniprot Q9HTY8 637-730

8. Domain d2ocea4: 2oce A:637-730 [148730]
   Other proteins in same PDB: d2ocea1, d2ocea2, d2ocea3, d2ocea5

Details for d2ocea4

PDB Entry: 2oce, 3.1 Å

PDB Description: crystal structure of tex family protein pa5201 from pseudomonas aeruginosa

PDB Compounds: (A:) Hypothetical protein PA5201

SCOPe Domain Sequences for d2ocea4:

Sequence; same for both SEQRES and ATOM records:

>d2ocea4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]}
fktaefqegveslkdlkpgmvlegvvtnvtnfgafvdigvhqdglvhisalsekfvkdpy
evvkagdivkvkvmevdiprnrvglsmrmsdtpg

Timeline for d2ocea4:

• d2ocea4 first appeared in SCOP 1.75
  
• d2ocea4 appears in SCOPe 2.04
  
• d2ocea4 appears in SCOPe 2.06
  
• d2ocea4 appears in the current release, SCOPe 2.08