Lineage for d2ocea4 (2oce A:637-730)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541947Protein Tex S1-domain [159106] (1 species)
  7. 1541948Species Pseudomonas aeruginosa [TaxId:287] [159107] (3 PDB entries)
    Uniprot Q9HTY8 637-730
  8. 1541951Domain d2ocea4: 2oce A:637-730 [148730]
    Other proteins in same PDB: d2ocea1, d2ocea2, d2ocea3, d2ocea5

Details for d2ocea4

PDB Entry: 2oce (more details), 3.1 Å

PDB Description: crystal structure of tex family protein pa5201 from pseudomonas aeruginosa
PDB Compounds: (A:) Hypothetical protein PA5201

SCOPe Domain Sequences for d2ocea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ocea4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]}
fktaefqegveslkdlkpgmvlegvvtnvtnfgafvdigvhqdglvhisalsekfvkdpy
evvkagdivkvkvmevdiprnrvglsmrmsdtpg

SCOPe Domain Coordinates for d2ocea4:

Click to download the PDB-style file with coordinates for d2ocea4.
(The format of our PDB-style files is described here.)

Timeline for d2ocea4: