Lineage for d2ocea3 (2oce A:2-324)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781517Fold a.294: Tex N-terminal region-like [158831] (1 superfamily)
    multihelical; irregular array of long and short helices; can be divided into several subdomains
  4. 781518Superfamily a.294.1: Tex N-terminal region-like [158832] (1 family) (S)
  5. 781519Family a.294.1.1: Tex N-terminal region-like [158833] (1 protein)
    Pfam PF09371
  6. 781520Protein Transcriptional accessory factor Tex [158834] (1 species)
  7. 781521Species Pseudomonas aeruginosa [TaxId:287] [158835] (3 PDB entries)
    Uniprot Q9HTY8 1-324! Uniprot Q9HTY8 2-324
  8. 781524Domain d2ocea3: 2oce A:2-324 [148729]
    Other proteins in same PDB: d2ocea1, d2ocea2, d2ocea4, d2ocea5

Details for d2ocea3

PDB Entry: 2oce (more details), 3.1 Å

PDB Description: crystal structure of tex family protein pa5201 from pseudomonas aeruginosa
PDB Compounds: (A:) Hypothetical protein PA5201

SCOP Domain Sequences for d2ocea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ocea3 a.294.1.1 (A:2-324) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}
dsintriaeelsalpsgrvqpqqvaaavalldegstvpfiaryrkevtgslddtqlrmle
erlrylreleerrgailasieeqgkltpelardikladtktrledlylpykqkrrtkgqi
aleaglgaladalfddptlvpeseaarfvdaekgfadvkavlegakyilmerfaedatll
dklrvfmkneatltarvvpgkeqegakfsdyfehdeplksapshralaifrgrnegvlsa
slkvgeeapgtlhpcevmiaerfglsnqgraadkwlaevvrwtwkvklythletdlfgel
rdgaedeaisvfarnlhdlllaa

SCOP Domain Coordinates for d2ocea3:

Click to download the PDB-style file with coordinates for d2ocea3.
(The format of our PDB-style files is described here.)

Timeline for d2ocea3: