Lineage for d2ocdb_ (2ocd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142623Protein Asparaginase type II [53776] (5 species)
  7. 2142676Species Vibrio cholerae [TaxId:666] [159797] (2 PDB entries)
    Uniprot Q9KQK3 2-337
  8. 2142678Domain d2ocdb_: 2ocd B: [148724]
    automated match to d2ocda1
    complexed with act, gol

Details for d2ocdb_

PDB Entry: 2ocd (more details), 2.45 Å

PDB Description: Crystal structure of L-asparaginase I from Vibrio cholerae O1 biovar eltor str. N16961
PDB Compounds: (B:) L-asparaginase I

SCOPe Domain Sequences for d2ocdb_:

Sequence, based on SEQRES records: (download)

>d2ocdb_ c.88.1.1 (B:) Asparaginase type II {Vibrio cholerae [TaxId: 666]}
arkhiyiaytggtigmkksdhgyvpvagfmekqlasmpefhrpemplftiheydplmdss
dmtpadwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipl
adlrsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlppll
eaginielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamill
tfgvgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgydm
tpeaalaklhyllsqnlsyeevkakmqqvlrgemtl

Sequence, based on observed residues (ATOM records): (download)

>d2ocdb_ c.88.1.1 (B:) Asparaginase type II {Vibrio cholerae [TaxId: 666]}
arkhiyiaytggtigmkksdvpvagfmekqlasmpefhrpemplftiheydplmdssdmt
padwqliaddiaanydkydgfvilhgtdtmaytasalsfmfenlgkpvivtgsqipladl
rsdgqanllnalhvaanypinevtlffnnrlmrgnrsrkshadgfsafsspnlpplleag
inielstnvkvdekpsgefkvnpitpqpigvitmypgishevirntllqpvnamilltfg
vgnapqnpellaqlkaasergvivvnltqclagkvnmggyatgcaladagvisgydmtpe
aalaklhyllsqnlsyeevkakmqqvlrgemtl

SCOPe Domain Coordinates for d2ocdb_:

Click to download the PDB-style file with coordinates for d2ocdb_.
(The format of our PDB-style files is described here.)

Timeline for d2ocdb_: