![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.4: YdhG-like [159888] (1 family) ![]() some similarity to YjbR-like ((136320)) some similarity to YjbR-like ((136320)) |
![]() | Family d.198.4.1: YdhG-like [159889] (2 proteins) Pfam PF08818; DUF1801 |
![]() | Protein Uncharacterized protein YdhG [159892] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [159893] (1 PDB entry) Uniprot Q797E6 1-123 |
![]() | Domain d2oc6b1: 2oc6 B:1-123 [148722] automatically matched to 2OC6 A:1-123 complexed with act, gol, so4 |
PDB Entry: 2oc6 (more details), 1.75 Å
SCOP Domain Sequences for d2oc6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oc6b1 d.198.4.1 (B:1-123) Uncharacterized protein YdhG {Bacillus subtilis [TaxId: 1423]} mdvfseylagiadpfhrerteevltwiknkypnlhteikwnqpmftdhgtfiigfsvskk hlavapekvtiahveddivkagydyteqliripwngpvdytllekmiefnildkadcstf wrk
Timeline for d2oc6b1: