Lineage for d2oc6b2 (2oc6 B:1-123)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005912Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3006073Superfamily d.198.4: YdhG-like [159888] (1 family) (S)
    some similarity to YjbR-like (136320)
    automatically mapped to Pfam PF08818
  5. 3006074Family d.198.4.1: YdhG-like [159889] (3 proteins)
    Pfam PF08818; DUF1801
  6. 3006079Protein Uncharacterized protein YdhG [159892] (1 species)
  7. 3006080Species Bacillus subtilis [TaxId:1423] [159893] (1 PDB entry)
    Uniprot Q797E6 1-123
  8. 3006082Domain d2oc6b2: 2oc6 B:1-123 [148722]
    Other proteins in same PDB: d2oc6a2, d2oc6b3
    automated match to d2oc6a1
    complexed with act, gol, so4

Details for d2oc6b2

PDB Entry: 2oc6 (more details), 1.75 Å

PDB Description: crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution
PDB Compounds: (B:) YdhG protein

SCOPe Domain Sequences for d2oc6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oc6b2 d.198.4.1 (B:1-123) Uncharacterized protein YdhG {Bacillus subtilis [TaxId: 1423]}
mdvfseylagiadpfhrerteevltwiknkypnlhteikwnqpmftdhgtfiigfsvskk
hlavapekvtiahveddivkagydyteqliripwngpvdytllekmiefnildkadcstf
wrk

SCOPe Domain Coordinates for d2oc6b2:

Click to download the PDB-style file with coordinates for d2oc6b2.
(The format of our PDB-style files is described here.)

Timeline for d2oc6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oc6b3