![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.4: YdhG-like [159888] (1 family) ![]() some similarity to YjbR-like (136320) automatically mapped to Pfam PF08818 |
![]() | Family d.198.4.1: YdhG-like [159889] (3 proteins) Pfam PF08818; DUF1801 |
![]() | Protein Uncharacterized protein YdhG [159892] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [159893] (1 PDB entry) Uniprot Q797E6 1-123 |
![]() | Domain d2oc6a1: 2oc6 A:1-123 [148721] Other proteins in same PDB: d2oc6a2, d2oc6b3 complexed with act, gol, so4 |
PDB Entry: 2oc6 (more details), 1.75 Å
SCOPe Domain Sequences for d2oc6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oc6a1 d.198.4.1 (A:1-123) Uncharacterized protein YdhG {Bacillus subtilis [TaxId: 1423]} mdvfseylagiadpfhrerteevltwiknkypnlhteikwnqpmftdhgtfiigfsvskk hlavapekvtiahveddivkagydyteqliripwngpvdytllekmiefnildkadcstf wrk
Timeline for d2oc6a1: