SCOPe 2.07: Domain d2oc6a1: 2oc6 A:1-123

Lineage for d2oc6a1 (2oc6 A:1-123)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.4: YdhG-like [159888] (1 family)
   some similarity to YjbR-like (136320)
   automatically mapped to Pfam PF08818

5. Family d.198.4.1: YdhG-like [159889] (3 proteins)
   Pfam PF08818; DUF1801

6. Protein Uncharacterized protein YdhG [159892] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [159893] (1 PDB entry)
   Uniprot Q797E6 1-123

8. Domain d2oc6a1: 2oc6 A:1-123 [148721]
   Other proteins in same PDB: d2oc6a2, d2oc6b3
   complexed with act, gol, so4

Details for d2oc6a1

PDB Entry: 2oc6, 1.75 Å

PDB Description: crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution

PDB Compounds: (A:) YdhG protein

SCOPe Domain Sequences for d2oc6a1:

Sequence; same for both SEQRES and ATOM records:

>d2oc6a1 d.198.4.1 (A:1-123) Uncharacterized protein YdhG {Bacillus subtilis [TaxId: 1423]}
mdvfseylagiadpfhrerteevltwiknkypnlhteikwnqpmftdhgtfiigfsvskk
hlavapekvtiahveddivkagydyteqliripwngpvdytllekmiefnildkadcstf
wrk

Timeline for d2oc6a1:

• d2oc6a1 first appeared in SCOP 1.75
  
• d2oc6a1 appears in SCOPe 2.06
  
• d2oc6a1 appears in the current release, SCOPe 2.08