![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.71: ReutB4095-like [158299] (1 protein) probable biological unit is a homohexamer |
![]() | Protein Putative DNA-binding protein ReutB4095 [158300] (1 species) |
![]() | Species Ralstonia eutropha [TaxId:106590] [158301] (1 PDB entry) Uniprot Q46TT3 12-92 |
![]() | Domain d2obpb_: 2obp B: [148719] automated match to d2obpa1 complexed with cl, no3 |
PDB Entry: 2obp (more details), 1.7 Å
SCOPe Domain Sequences for d2obpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2obpb_ a.4.5.71 (B:) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]} gidpaivevllvlreagiengatpwslpkiakraqlpmsvlrrvltqlqaagladvsvea dgrghasltqegaalaaqlfp
Timeline for d2obpb_: