Lineage for d2ob5a1 (2ob5 A:1-147)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1189632Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 1189633Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 1189634Family c.133.1.1: RbsD-like [102547] (2 proteins)
  6. 1189635Protein Hypothetical protein Atu2016 [159677] (1 species)
  7. 1189636Species Agrobacterium tumefaciens [TaxId:358] [159678] (1 PDB entry)
    Uniprot Q8UDV3 1-147
  8. 1189637Domain d2ob5a1: 2ob5 A:1-147 [148714]

Details for d2ob5a1

PDB Entry: 2ob5 (more details), 1.6 Å

PDB Description: Crystal structure of protein Atu2016, putative sugar binding protein
PDB Compounds: (A:) Hypothetical protein Atu2016

SCOPe Domain Sequences for d2ob5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ob5a1 c.133.1.1 (A:1-147) Hypothetical protein Atu2016 {Agrobacterium tumefaciens [TaxId: 358]}
mlknidpalnadvlhalramghgdtlvisdtnfpsdsvarqttvgkvlhidnvsaaramk
ailsvlpldtplqpsvgrmevmgapdqlepvqvevqqeidaaegksapmygierfafyek
akqaycvittgetrfygcflltkgvip

SCOPe Domain Coordinates for d2ob5a1:

Click to download the PDB-style file with coordinates for d2ob5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ob5a1: