SCOPe 2.08: Domain d2ob5a1: 2ob5 A:1-147

Lineage for d2ob5a1 (2ob5 A:1-147)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.133: RbsD-like [102545] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest

4. Superfamily c.133.1: RbsD-like [102546] (2 families)

5. Family c.133.1.1: RbsD-like [102547] (2 proteins)
   automatically mapped to Pfam PF05025

6. Protein Hypothetical protein Atu2016 [159677] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [159678] (1 PDB entry)
   Uniprot Q8UDV3 1-147

8. Domain d2ob5a1: 2ob5 A:1-147 [148714]
   Other proteins in same PDB: d2ob5a2

Details for d2ob5a1

PDB Entry: 2ob5, 1.6 Å

PDB Description: Crystal structure of protein Atu2016, putative sugar binding protein

PDB Compounds: (A:) Hypothetical protein Atu2016

SCOPe Domain Sequences for d2ob5a1:

Sequence; same for both SEQRES and ATOM records:

>d2ob5a1 c.133.1.1 (A:1-147) Hypothetical protein Atu2016 {Agrobacterium tumefaciens [TaxId: 358]}
mlknidpalnadvlhalramghgdtlvisdtnfpsdsvarqttvgkvlhidnvsaaramk
ailsvlpldtplqpsvgrmevmgapdqlepvqvevqqeidaaegksapmygierfafyek
akqaycvittgetrfygcflltkgvip

Timeline for d2ob5a1:

• d2ob5a1 first appeared in SCOP 1.75
  
• d2ob5a1 appears in SCOPe 2.07