Lineage for d2oaia1 (2oai A:5-91)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987644Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 2987645Protein Hemolysin TlyC [160839] (1 species)
  7. 2987646Species Xylella fastidiosa [TaxId:2371] [160840] (2 PDB entries)
    Uniprot Q87DZ3 353-439! Uniprot Q87DZ3 355-439
  8. 2987647Domain d2oaia1: 2oai A:5-91 [148705]
    complexed with ca, edo

Details for d2oaia1

PDB Entry: 2oai (more details), 1.8 Å

PDB Description: The structure of transporter associated domain CorC_HlyC from a Xylella fastidiosa Temecula1 hemolysin.
PDB Compounds: (A:) Hemolysin

SCOPe Domain Sequences for d2oaia1:

Sequence, based on SEQRES records: (download)

>d2oaia1 d.145.1.4 (A:5-91) Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]}
edalmvtredgsflidgtlpieelrevlgaelpdgeennyhtlagmcisyfgriphvgey
fdwagwrieivdldgaridklllqrln

Sequence, based on observed residues (ATOM records): (download)

>d2oaia1 d.145.1.4 (A:5-91) Hemolysin TlyC {Xylella fastidiosa [TaxId: 2371]}
edalmvtredgsflidgtlpieelrevlgannyhtlagmcisyfgriphvgeyfdwagwr
ieivdldgaridklllqrln

SCOPe Domain Coordinates for d2oaia1:

Click to download the PDB-style file with coordinates for d2oaia1.
(The format of our PDB-style files is described here.)

Timeline for d2oaia1: