![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins) N-terminal domain is a 8-bladed beta-propeller |
![]() | Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82499] (29 PDB entries) Uniprot P27487 39-776 Uniprot P27487 Uniprot P27487 Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487 |
![]() | Domain d2oaga2: 2oag A:509-764 [148698] Other proteins in same PDB: d2oaga1, d2oagb1, d2oagc1, d2oagd1 automatically matched to d1orva2 complexed with dli |
PDB Entry: 2oag (more details), 2.3 Å
SCOP Domain Sequences for d2oaga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oaga2 c.69.1.24 (A:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfs
Timeline for d2oaga2: