SCOPe 2.07: Domain d2oafb_: 2oaf B:

Lineage for d2oafb_ (2oaf B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Hypothetical protein Jann0674 [160180] (1 species)

7. Species Jannaschia sp. CCS1 [TaxId:290400] [160181] (1 PDB entry)
   Uniprot Q28UM1 1-143

8. Domain d2oafb_: 2oaf B: [148696]
   automated match to d2oafa1
   complexed with cit, cl, pge, po4

Details for d2oafb_

PDB Entry: 2oaf, 2 Å

PDB Description: crystal structure of thioesterase superfamily (yp_508616.1) from jannaschia sp. ccs1 at 2.00 a resolution

PDB Compounds: (B:) Thioesterase superfamily

SCOPe Domain Sequences for d2oafb_:

Sequence; same for both SEQRES and ATOM records:

>d2oafb_ d.38.1.1 (B:) Hypothetical protein Jann0674 {Jannaschia sp. CCS1 [TaxId: 290400]}
lmqprpdsafvhdvrvtwgdcdpakiaytghlprfaleaidawwseyhgpggwyhleldt
nvgtpfvrlemdfkspvtprhilkchtwptrlgtksitfrvdgvqdgvtcfvgaftcvft
iadqfksqpapdhlraliephipa

Timeline for d2oafb_:

• d2oafb_ first appeared in SCOP 1.75, called d2oafb1
  
• d2oafb_ appears in SCOPe 2.06
  
• d2oafb_ appears in the current release, SCOPe 2.08