Lineage for d2oafb_ (2oaf B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943567Protein Hypothetical protein Jann0674 [160180] (1 species)
  7. 2943568Species Jannaschia sp. CCS1 [TaxId:290400] [160181] (1 PDB entry)
    Uniprot Q28UM1 1-143
  8. 2943570Domain d2oafb_: 2oaf B: [148696]
    automated match to d2oafa1
    complexed with cit, cl, pge, po4

Details for d2oafb_

PDB Entry: 2oaf (more details), 2 Å

PDB Description: crystal structure of thioesterase superfamily (yp_508616.1) from jannaschia sp. ccs1 at 2.00 a resolution
PDB Compounds: (B:) Thioesterase superfamily

SCOPe Domain Sequences for d2oafb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oafb_ d.38.1.1 (B:) Hypothetical protein Jann0674 {Jannaschia sp. CCS1 [TaxId: 290400]}
lmqprpdsafvhdvrvtwgdcdpakiaytghlprfaleaidawwseyhgpggwyhleldt
nvgtpfvrlemdfkspvtprhilkchtwptrlgtksitfrvdgvqdgvtcfvgaftcvft
iadqfksqpapdhlraliephipa

SCOPe Domain Coordinates for d2oafb_:

Click to download the PDB-style file with coordinates for d2oafb_.
(The format of our PDB-style files is described here.)

Timeline for d2oafb_: